Recombinant Proteins

Modified or manipulated proteins encoded by recombinant DNA and suitable for a variety of purposes including the modification of gene sequences, mass protein production, and the manufacture of commercial products.

4,186 – 4,200 of 115,743 results

4,186

Novus Biologicals™ Recombinant Human ELAC1 His Protein

Highly purified. Generating reliable and reproducible results.

Pricing & Availability
Specifications

Purity or Quality Grade	>80%, by SDS-PAGE under reducing conditions and visualized by Colloidal Coomassie™ Blue stain
Conjugate	Unconjugated
Gene Alias	D29elaC (E. coli) homolog 1, Deleted in Ma29, EC 3.1.26.11, elaC homolog 1 (E. coli), ElaC homolog protein 1, FLJ59261, Ribonuclease Z 1, RNase Z 1, tRNA 3 endonuclease 1, tRNA 3' processing endoribonuclease, tRNA Z (short form), tRNase Z 1, tRNase ZS, zinc phosphodiesterase ELAC protein 1
Common Name	ELAC1
Molecular Weight (g/mol)	TMW: 42.4kDa
Gene ID (Entrez)	55520
Formulation	Phosphate buffered saline (pH7.4) containing 10% glycerol, 1mM DTT
Storage Requirements	Store at 4°C short term. Aliquot and store at −20°C long term. Avoid freeze-thaw cycles.
Concentration	0.5mg/mL
For Use With (Application)	SDS-PAGE
Recombinant	Recombinant

4,187

R&D Systems™ Recombinant Rat TRANCE/RANK L/TNFSF11 Protein

Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility.

Pricing & Availability
Specifications

Purity or Quality Grade	>85%, by SDS-PAGE visualized with Silver Staining and quantitative densitometry by Coomassie™ Blue Staining
Conjugate	Unconjugated
Quantity	25 μg
Endotoxin Concentration	<0.10 EU per 1μg of the protein by the LAL method.
Storage Requirements	Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70° C as supplied. 1 month, 2 to 8° C under sterile conditions after reconstitution. 3 months, -20 to -70° C under sterile conditions after reconstitution.
For Use With (Application)	Bioactivity
Source	Chinese Hamster Ovary cell line,CHO-derived rat TRANCE/TNFSF11/RANK L protein Arg72-Asp318,with an N-terminal 6-His tag
Accession Number	XP_008769150
Regulatory Status	RUO
Gene Alias	CD254, CD254 antigen, ODF, OPGL, OPGLOPTB2
Product Type	Recombinant protein
Biological Activity	2.5 to 15ng/mL
Gene ID (Entrez)	8600
Species	Rat
Recombinant	Recombinant

4,188

Novus Biologicals™ Recombinant Human Pellino 2 His Protein

Highly purified. Generating reliable and reproducible results.

Pricing & Availability
Specifications

Purity or Quality Grade	>80%, by SDS-PAGE under reducing conditions and visualized by Colloidal Coomassie™ Blue stain
Conjugate	Unconjugated
Gene Alias	pellino (Drosophila) homolog 2, pellino homolog 2 (Drosophila), Pellino-2, protein pellino homolog 2
Common Name	Pellino 2
Molecular Weight (g/mol)	TMW: 48.8kDa
Gene ID (Entrez)	57161
Formulation	20mM Tris-HCl buffer (pH 8.0) containing 0.15M NaCl, 20% glycerol, 1mM DTT
Storage Requirements	Store at 4°C short term. Aliquot and store at −20°C long term. Avoid freeze-thaw cycles.
Concentration	0.5mg/mL
For Use With (Application)	SDS-PAGE
Recombinant	Recombinant

4,189

R&D Systems™ Recombinant Mouse IL-34 His-tag Protein, CF

Recombinant Protein

Pricing & Availability
Specifications

Accession Number	Q8R1R4.1
Conjugate	Unconjugated
Gene Alias	C16orf77, IL34, IL-34, interleukin 34
Molecular Weight (g/mol)	M.W.-observed: 21-32 kDa, under reducing conditions, M.W.-theroretical: 21 kDa
Gene ID (Entrez)	146433
Formulation	Lyophilized from a 0.2 μm filtered solution in PBS with Trehalose.
Reconstitution	Reconstitute the 10 μg size at 100 μg/mL in water. Reconstitute all other sizes at 500 μg/mL in water.
Endotoxin Concentration	<0.10 EU per 1 μg of the protein by the LAL method.
Storage Requirements	Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 °C as supplied. 1 month, 2 to 8 °C under sterile conditions after reconstitution. 3 months, -20 to -70 °C under sterile conditions after reconstitution.
For Use With (Application)	Bioactivity
Protein	IL-34
Source	Chinese Hamster Ovary cell line, CHO-derived mouse IL-34 protein Asn21-Leu193, with a C-terminal 6-His tag

4,190

Novus Biologicals™ Recombinant Human Sodium Potassium ATPase Beta 1 Protein

Highly purified. Generating reliable and reproducible results. Applications: SDS-Page

Pricing & Availability
Specifications

Conjugate	Unconjugated
Molecular Weight (g/mol)	30.4kDa
Storage Requirements	Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
For Use With (Application)	SDS-PAGE
Source	E.Coli
Name	Human Sodium Potassium ATPase Beta 1 Protein
Regulatory Status	RUO
Purification Method	>90%, by SDS-PAGE
Gene Alias	adenosinetriphosphatase, ATP1B, ATPase, Na+/K+ transporting, beta 1 polypeptide, Beta 1-subunit of Na(+), K(+)-ATPase, MGC1798, Na, K-ATPase beta-1 polypeptide, sodium/potassium-dependent ATPase beta-1 subunit, Sodium/potassium-dependent ATPase subunit beta-1, sodium/potassium-transporting ATPase beta-1 chain, sodium/potassium-transporting ATPase subunit beta-1
Product Type	Recombinant Protein
Gene ID (Entrez)	481
Formulation	20mM Tris-HCl buffer (pH 8.0) containing 10% glycerol, 0.4M urea
Immunogen	MGSSHHHHHH SSGLVPRGSH MGSEFKPTYQ DRVAPPGLTQ IPQIQKTEIS FRPNDPKSYE AYVLNIVRFL EKYKDSAQRD DMIFEDCGDV PSEPKERGDF NHERGERKVC RFKLEWLGNC SGLNDETYGY KEGKPCIIIK LNRVLGFKPK PPKNESLETY PVMKYNPNVL PVQCTGKRDE DKDKVGNVEY FGLGNSPGFP LQYYPYYGKL LQPKYLQPLL AVQFTNLTMD TEIRIECKAY GENIGYSEKD RFQGRFDVKI EVKS
Cross Reactivity	Human
Recombinant	Recombinant

4,191

R&D Systems™ Recombinant Human ASP/C3a desArg Protein

Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility.

Pricing & Availability

4,192

R&D Systems™ Recombinant Human Pentraxin 2/SAP His-tag Protein

The Recombinant Human Pentraxin 2/SAP His-tag Protein is derived from NS0

Pricing & Availability

4,193

Novus Biologicals™ Recombinant Human RPIA His Protein

Highly purified. Generating reliable and reproducible results.

Pricing & Availability

4,194

Novus Biologicals™ Recombinant Human alpha-Synuclein Aggregate Protein (Biologically Active)

Highly purified and high bioactivity. Generating reliable and reproducible results.

Pricing & Availability
Specifications

Conjugate	Unconjugated
Gene Symbol	SNCA
For Use With (Application)	In vitro Assay,In vivo Assay,SDS-PAGE,Western Blot
Source	E.Coli
Name	Human alpha-Synuclein Aggregate Protein
Regulatory Status	RUO
Purification Method	>95% pure by SDS-PAGE
Gene Alias	alpha-Synuclein, Lewy body 4, MGC110988, non A-beta component of AD amyloid, Non-A beta component of AD amyloid, non-A4 component of amyloid, Non-A4 component of amyloid precursor, PARK1, PARK4, synuclein, alpha (non A4 component of amyloid precursor)
Product Type	Recombinant Protein
Gene ID (Entrez)	6622
Formulation	PBS
Immunogen	MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA
Cross Reactivity	Human
Recombinant	Recombinant

4,195

MP Biomedicals™ Neuromedin B

Pricing & Availability

4,196

R&D Systems™ Recombinant Cynomolgus Monkey Mer His-tag Protein

Pricing & Availability

4,197

Novus Biologicals™ Aldolase B Protein

Highly purified. Generating reliable and reproducible results.

Pricing & Availability
Specifications

Regulatory Status	RUO
Purification Method	SDS-PAGE
Purity or Quality Grade	>95%
Conjugate	Unconjugated
Common Name	Aldolase B
Storage Requirements	Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
For Use With (Application)	SDS-PAGE
Source	Human

4,198

Invitrogen™ Human JAK2, GST Tag Recombinant Protein

Recombinant Protein

Pricing & Availability
Specifications

Purity or Quality Grade	95% by SDS-PAGE
Conjugate	Unconjugated
Form	Liquid
Common Name	JAK2
Molecular Weight (g/mol)	66.6 kDa
Concentration	See Label
Expression System	Insect cells
For Use With (Application)	Kinase Assay
Name	Human JAK2, GST Tag
Accession Number	O60674
Gene Alias	EC 2.7.10.2; Fd17; JAK 2; JAK2; JAK-2; Janus kinase 2; Janus kinase 2 (a protein tyrosine kinase); JTK 10; JTK10; kinase Jak2; THCYT3; Tyrosine-protein kinase JAK2
Gene ID (Entrez)	3717
Protein Tag	GST-tag
Species	Human
Recombinant	Recombinant

4,199

Novus Biologicals™ Recombinant Human PRRT2 His Protein

Highly purified. Generating reliable and reproducible results.

Pricing & Availability
Specifications

Purity or Quality Grade	>85%, by SDS-PAGE
Conjugate	Unconjugated
Gene Alias	DKFZp547J199, FLJ25513, IFITMD1, interferon induced transmembrane protein domain containing 1, proline-rich transmembrane protein 2
Common Name	PRRT2
Molecular Weight (g/mol)	TMW: 29.7kDa
Gene ID (Entrez)	112476
Formulation	20mM Tris-HCl buffer (pH 8.0) containing 0.15M NaCl, 10% glycerol, 1mM DTT
Storage Requirements	Store at 4°C short term. Aliquot and store at −20°C long term. Avoid freeze-thaw cycles.
Concentration	0.25mg/mL
For Use With (Application)	SDS-PAGE
Recombinant	Recombinant

4,200

Novus Biologicals™ Crk Protein

Highly purified. Generating reliable and reproducible results.

Pricing & Availability
Specifications

Regulatory Status	RUO
Purification Method	SDS-PAGE
Purity or Quality Grade	>95%
Conjugate	Unconjugated
Common Name	Crk
Molecular Weight (g/mol)	25.0kDa
Formulation	Liquid. In 20mM Tris-HCl Buffer (pH 8.0) containing 10% Glycerol
Storage Requirements	Store at -80°C. Avoid freeze-thaw cycles.
Concentration	0.5mg/mL
For Use With (Application)	SDS-PAGE,Western Blot

Prev
1
...
278
279
280
281
...
7,717
Next

Welcome to fishersci.com

Recombinant Proteins

Filtered Search Results

Narrow Results

Novus Biologicals™ Recombinant Human ELAC1 His Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ Recombinant Human Pellino 2 His Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ Recombinant Human Sodium Potassium ATPase Beta 1 Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ Recombinant Human RPIA His Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ Recombinant Human alpha-Synuclein Aggregate Protein (Biologically Active) Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ Aldolase B Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ Recombinant Human PRRT2 His Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ Crk Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ Recombinant Human ELAC1 His Protein

Novus Biologicals™ Recombinant Human Pellino 2 His Protein

Novus Biologicals™ Recombinant Human Sodium Potassium ATPase Beta 1 Protein

Novus Biologicals™ Recombinant Human RPIA His Protein

Novus Biologicals™ Recombinant Human alpha-Synuclein Aggregate Protein (Biologically Active)

Novus Biologicals™ Aldolase B Protein

Novus Biologicals™ Recombinant Human PRRT2 His Protein

Novus Biologicals™ Crk Protein